Alkali Metal Salts
Alkali metal salts are naturally-occurring compounds available in a wide variety of chemical compositions, quantities, purities, and reagent grades. They have numerous chemical, biological, pharmaceutical, educational, research, and everyday applications.
Quantity
- (1)
- (4)
- (1)
- (41)
- (248)
- (11)
- (2)
- (102)
- (1)
- (1)
- (498)
- (1)
- (2)
- (1)
- (1)
- (1)
- (2)
- (38)
- (191)
- (105)
- (1)
- (4)
- (1)
- (14)
- (2)
- (1)
- (751)
- (2)
- (7)
- (59)
- (14)
- (25)
- (1)
- (1)
- (1)
- (2)
- (283)
- (5)
- (2)
- (113)
- (1)
- (1)
- (2)
- (1)
- (1)
- (1)
- (1)
- (4)
- (13)
- (72)
- (1)
- (1)
- (15)
- (6)
- (624)
- (66)
- (2)
- (2)
- (1)
- (1)
- (7)
- (1)
- (4)
- (2)
- (1)
- (1)
- (474)
- (70)
- (4)
- (1)
- (1)
- (3)
- (1)
- (298)
- (7)
- (26)
- (5)
- (37)
- (1)
- (1)
- (75)
- (1)
- (4)
- (6)
- (1)
- (1)
- (151)
- (1)
- (2)
- (1)
- (44)
- (5)
- (1)
- (2)
- (11)
- (2)
- (1)
- (74)
- (2)
- (1)
- (3)
- (233)
- (185)
- (2)
- (1)
- (1)
- (3)
- (1)
- (1)
- (1)
- (1)
- (2)
- (1)
- (222)
- (160)
- (4)
- (3)
- (6)
- (1,357)
- (1)
- (202)
- (14)
- (18)
- (4)
- (5)
- (6)
- (41)
- (6)
- (3)
- (7)
- (1)
- (1)
- (3)
- (53)
- (4)
- (2)
- (2)
- (18)
- (1)
- (2)
Molecular Weight (g/mol)
- (3)
- (1)
- (1)
- (41)
- (4)
- (71)
- (1)
- (1)
- (6)
- (2)
- (4)
- (8)
- (55)
- (1)
- (4)
- (20)
- (1)
- (1)
- (1)
- (1)
- (2)
- (2)
- (1)
- (1)
- (3)
- (1)
- (1)
- (2)
- (115)
- (1)
- (6)
- (16)
- (1)
- (6)
- (1)
- (1)
- (1)
- (1)
- (10)
- (21)
- (4)
- (4)
- (1)
- (1)
- (1)
- (1)
- (3)
- (1)
- (13)
- (2)
- (1)
- (2)
- (3)
- (5)
- (2)
- (3)
- (4)
- (90)
- (40)
- (1)
- (3)
- (12)
- (2)
- (2)
- (25)
- (8)
- (2)
- (3)
- (2)
- (4)
- (14)
- (24)
- (20)
- (2)
- (1)
- (2)
- (1)
- (5)
- (32)
- (13)
- (1)
- (2)
- (13)
- (6)
- (2)
- (5)
- (1)
- (1)
- (1)
- (1)
- (1)
- (23)
- (8)
- (2)
- (2)
- (17)
- (2)
- (1)
- (43)
- (112)
- (3)
- (5)
- (2)
- (1)
- (19)
- (2)
- (1)
- (8)
- (7)
- (4)
- (3)
- (3)
- (16)
- (1)
- (4)
- (2)
- (60)
- (11)
- (1)
- (61)
- (17)
- (2)
- (1)
- (4)
- (86)
- (4)
- (2)
- (134)
- (9)
- (1)
- (2)
- (3)
- (13)
- (3)
- (2)
- (1)
- (33)
- (2)
- (39)
- (11)
- (10)
- (4)
- (3)
- (3)
- (4)
- (13)
- (5)
- (8)
- (1)
- (2)
- (4)
- (4)
- (3)
- (1)
- (12)
- (11)
- (3)
- (3)
- (19)
- (68)
- (2)
- (42)
- (2)
- (1)
- (2)
- (1)
- (3)
- (3)
- (2)
- (2)
- (2)
- (7)
- (4)
- (3)
- (5)
- (1)
- (1)
- (2)
- (14)
- (1)
- (1)
- (4)
- (3)
- (10)
- (1)
- (53)
- (105)
- (3)
- (2)
- (1)
- (16)
- (6)
- (10)
- (12)
- (3)
- (87)
- (1)
- (1)
- (16)
- (7)
- (2)
- (1)
- (1)
- (1)
- (4)
- (1)
- (2)
- (2)
- (1)
- (6)
- (10)
- (5)
- (2)
- (1)
- (2)
- (2)
- (7)
- (2)
- (2)
- (60)
- (3)
- (10)
- (2)
- (1)
- (64)
- (1)
- (2)
- (2)
- (29)
- (1)
- (2)
- (1)
- (166)
- (2)
- (1)
- (5)
- (1)
- (16)
- (5)
- (8)
- (2)
- (2)
- (1)
- (2)
- (11)
- (4)
- (5)
- (1)
- (1)
- (2)
- (1)
- (2)
- (8)
- (15)
- (1)
- (4)
- (2)
- (6)
- (2)
- (57)
- (1)
- (2)
- (2)
- (8)
- (3)
- (3)
- (3)
- (1)
- (1)
- (20)
- (10)
- (7)
- (3)
- (3)
- (3)
- (2)
- (5)
- (2)
- (5)
- (1)
- (2)
- (2)
- (12)
- (1)
- (6)
- (2)
- (2)
- (1)
- (4)
- (14)
- (1)
- (1)
- (2)
- (1)
- (2)
- (3)
- (5)
- (2)
- (9)
- (9)
- (3)
- (1)
- (1)
- (3)
- (4)
- (3)
- (9)
- (14)
- (1)
- (2)
- (2)
- (14)
- (25)
- (6)
- (40)
- (2)
- (2)
- (2)
- (2)
- (3)
- (2)
- (1)
- (2)
- (1)
- (3)
- (3)
- (5)
- (7)
- (3)
- (2)
- (6)
- (3)
- (23)
- (3)
- (1)
- (2)
- (1)
- (2)
- (28)
- (13)
- (14)
- (4)
- (5)
- (7)
- (1)
- (4)
- (3)
- (7)
- (1)
- (8)
- (2)
- (1)
- (1)
- (2)
- (1)
- (2)
- (1)
- (1)
- (2)
- (4)
- (2)
- (1)
- (5)
- (8)
- (2)
- (3)
- (2)
- (1)
- (1)
- (2)
- (2)
- (1)
- (2)
- (15)
- (2)
- (6)
- (1)
- (1)
- (8)
- (1)
- (13)
- (2)
- (2)
- (22)
- (1)
- (1)
- (2)
- (2)
- (3)
- (3)
- (64)
- (32)
- (11)
- (32)
- (3)
- (6)
- (1)
- (10)
- (8)
- (2)
- (11)
- (2)
- (4)
- (2)
- (6)
- (19)
- (1)
- (1)
- (2)
- (1)
- (2)
- (1)
- (2)
- (1)
- (2)
- (14)
- (7)
- (3)
- (1)
- (44)
- (3)
- (1)
- (5)
- (5)
- (7)
- (25)
- (5)
- (3)
- (1)
- (1)
- (6)
- (3)
- (4)
- (9)
- (1)
- (5)
- (6)
- (11)
- (3)
- (3)
- (16)
- (13)
- (1)
- (2)
- (2)
- (3)
- (7)
- (2)
- (13)
- (1)
- (4)
- (1)
- (1)
- (4)
- (4)
- (5)
- (1)
- (1)
- (3)
- (2)
- (30)
- (1)
- (10)
- (42)
- (8)
- (5)
- (3)
- (20)
- (16)
- (1)
- (5)
- (2)
- (1)
- (1)
- (4)
- (2)
- (5)
- (2)
- (1)
- (2)
- (1)
- (4)
- (1)
- (2)
- (5)
- (2)
- (1)
- (5)
- (1)
- (6)
- (2)
- (12)
- (26)
- (7)
- (1)
- (2)
- (2)
- (2)
- (2)
- (4)
Grade
- (891)
- (378)
- (1)
- (5)
- (1)
- (4)
- (2)
- (4)
- (3)
- (1)
- (98)
- (1)
- (214)
- (90)
- (26)
- (4)
- (7)
- (1)
- (10)
- (2)
- (46)
- (28)
- (5)
- (5)
- (189)
- (139)
- (1)
- (2)
- (19)
- (1)
- (1)
- (3)
- (3)
- (3)
- (1)
- (2)
- (189)
- (141)
- (17)
- (48)
- (3)
- (28)
- (2)
- (8)
- (181)
- (29)
- (34)
- (5)
- (15)
- (40)
- (3)
- (20)
- (4)
- (21)
- (6)
- (42)
- (177)
- (51)
- (1)
- (655)
- (3)
- (1)
- (12)
- (5)
- (3)
- (9)
- (3)
- (159)
- (1)
- (2)
- (49)
- (11)
- (4)
- (143)
- (1)
- (9)
- (12)
- (16)
- (3)
- (71)
- (38)
- (10)
- (2)
Percent Purity
- (5)
- (2)
- (21)
- (6)
- (1)
- (3)
- (2)
- (2)
- (2)
- (3)
- (1)
- (2)
- (7)
- (4)
- (2)
- (4)
- (11)
- (4)
- (1)
- (2)
- (2)
- (2)
- (2)
- (3)
- (4)
- (1)
- (16)
- (1)
- (6)
- (7)
- (2)
- (11)
- (4)
- (6)
- (1)
- (2)
- (3)
- (38)
- (3)
- (1)
- (14)
- (1)
- (1)
- (1)
- (125)
- (4)
- (3)
- (23)
- (4)
- (3)
- (2)
- (4)
- (3)
- (2)
- (6)
- (39)
- (2)
- (3)
- (20)
- (1)
- (2)
- (465)
- (3)
- (1)
- (2)
- (7)
- (11)
- (2)
- (1)
- (1)
- (103)
- (1)
- (1)
- (3)
- (1)
- (2)
- (1)
- (24)
- (2)
- (2)
- (1)
- (2)
- (4)
- (80)
- (9)
- (1)
- (3)
- (3)
- (3)
- (2)
- (2)
- (3)
- (7)
- (3)
- (11)
- (17)
- (2)
- (6)
- (4)
- (1)
- (2)
- (4)
- (2)
- (1)
- (2)
- (6)
- (1)
- (8)
- (2)
- (25)
- (3)
- (3)
- (5)
- (2)
- (2)
- (3)
- (1)
- (1)
- (1)
- (9)
- (19)
- (1)
- (23)
- (13)
- (1)
- (2)
- (2)
- (2)
- (2)
- (2)
- (2)
- (3)
- (8)
- (2)
- (5)
- (3)
- (3)
- (3)
- (5)
- (4)
- (5)
- (12)
- (1)
- (2)
- (1)
- (1)
- (1)
- (1)
- (2)
- (1)
- (3)
- (1)
- (1)
- (1)
- (4)
- (4)
- (5)
- (1)
- (5)
- (4)
- (1)
- (2)
- (1)
- (3)
- (4)
- (2)
- (4)
- (21)
- (8)
- (5)
- (1)
- (53)
- (1)
- (1)
- (2)
- (1)
- (9)
- (1)
- (1)
- (7)
- (1)
- (3)
- (1)
- (1)
- (4)
- (1)
- (8)
- (4)
- (1)
- (1)
- (4)
- (1)
- (4)
- (2)
- (1)
- (1)
- (1)
- (1)
- (1)
- (3)
- (1)
- (2)
- (1)
- (1)
- (3)
- (5)
- (2)
- (2)
- (1)
- (1)
- (5)
- (2)
- (3)
- (2)
- (2)
- (2)
- (13)
- (2)
- (3)
- (4)
- (3)
- (6)
- (1)
- (1)
- (5)
- (5)
- (2)
- (2)
- (3)
- (4)
- (4)
- (1)
- (4)
- (1)
- (3)
- (4)
- (1)
- (4)
- (3)
- (1)
- (2)
- (2)
- (3)
- (1)
- (2)
- (11)
- (2)
- (6)
- (5)
- (17)
- (4)
- (1)
- (1)
- (1)
- (4)
- (26)
- (2)
- (4)
- (3)
- (4)
- (3)
- (6)
- (1)
- (4)
- (3)
- (71)
- (1)
- (1)
- (40)
- (2)
- (6)
- (4)
- (123)
- (4)
- (3)
- (1)
- (4)
- (1)
- (33)
- (13)
- (18)
- (47)
- (1)
- (1)
- (30)
- (279)
- (8)
- (2)
- (8)
- (1)
- (12)
- (6)
- (1)
- (1)
- (1)
- (5)
- (3)
- (1)
- (12)
- (8)
- (1)
- (1)
- (9)
- (4)
- (34)
- (11)
- (119)
- (6)
- (15)
- (51)
- (2)
- (27)
- (14)
- (11)
- (1)
- (7)
- (539)
- (2)
- (1)
- (35)
- (2)
- (5)
- (8)
- (7)
- (3)
- (17)
- (2)
- (2)
- (2)
- (2)
- (1)
- (2)
- (2)
- (2)
- (1)
- (18)
- (1)
- (3)
- (2)
- (2)
- (4)
- (3)
- (2)
- (1)
- (45)
- (1)
- (2)
- (3)
- (7)
- (1)
- (5)
- (1)
- (4)
- (8)
- (7)
- (9)
- (103)
- (2)
- (5)
- (4)
- (1)
- (22)
- (5)
- (3)
- (2)
- (2)
- (3)
- (22)
- (2)
- (6)
- (58)
- (18)
- (8)
- (20)
- (13)
- (3)
- (15)
- (6)
- (46)
- (28)
- (2)
- (9)
- (9)
- (2)
- (2)
- (13)
- (1)
- (19)
- (2)
- (58)
- (28)
- (1)
- (4)
- (2)
- (2)
- (2)
- (2)
- (7)
Physical Form
- (4)
- (2)
- (10)
- (2)
- (9)
- (34)
- (3)
- (1)
- (57)
- (7)
- (2)
- (2)
- (14)
- (2)
- (4)
- (399)
- (16)
- (1)
- (4)
- (1)
- (5)
- (372)
- (6)
- (85)
- (2)
- (3)
- (2)
- (4)
- (21)
- (1)
- (4)
- (23)
- (2)
- (2)
- (3)
- (3)
- (247)
- (2)
- (17)
- (3)
- (11)
- (2)
- (16)
- (4)
- (2)
- (7)
- (53)
- (4)
- (8)
- (72)
- (3)
- (9)
- (2)
- (2)
- (2)
- (1)
- (3)
- (3)
- (11)
- (3)
- (2)
- (15)
- (19)
- (5)
- (207)
- (3)
- (627)
- (2)
- (17)
- (3)
- (3)
- (3)
- (2)
- (21)
- (2)
- (670)
- (3)
- (3)
- (5)
- (6)
- (5)
- (5)
- (6)
- (8)
- (18)
- (87)
- (2)
- (1)
- (1)
- (2)
- (4)
- (568)
- (22)
- (2)
- (2)
- (2)
- (5)
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
Search Within Results
Keyword Search:
Clear All
3,211
–
3,225
of
7,495
results
3,211
Medchemexpress LLC Amylin, amide, human TFA | 98.8% | 4017.30 | 1 MG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Amylin, amide, human TFA is a 37-amino acid polypeptide and a pancreatic hormone that is cosecreted with insulin. It plays unique roles in metabolism and glucose homeostasis by inhibiting glucagon secretion, delaying gastric emptying, and acting as a satiety agent. This product is for research use only and not sold to patients.
- Inhibits glucagon secretion
- Delays gastric emptying
- Acts as a satiety agent
- Stimulates human amylin receptor CTR1 and CTR2 in MCF-7 cells with an EC50 of 35.2 ± 7.5 nM
- Exhibits a half-time of 23 minutes in Swiss male mice after subcutaneous injection
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
3,212
Medchemexpress LLC Amylin, amide, human | 122384-88-7 | >98.3% | 3903.28 | 500 UG
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Amylin, amide, human is a 37-amino acid polypeptide, a pancreatic hormone cosecreted with insulin. It plays crucial roles in metabolism and glucose homeostasis, inhibiting glucagon secretion, delaying gastric emptying, and acting as a satiety agent.
- Appearance: Solid
- Color: White to off-white
- Chemical formula: C165H261N51O55S2
- Sequence shortening: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 (Disulfide bridge: Cys2-Cys7)
- Inhibits glucagon secretion
- Delays gastric emptying
- Acts as a satiety agent
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
3,213
![Research Products International Corp NADP [B-Nicotinamide Adenine Dinucleotide Phosphate, Oxidized Form, Monosodium Salt Trihydrate], 100 Milligrams](https://assets.fishersci.com/TFS-Assets/CCG/product-images/VN00006095-N20120-0.1.JPG-250.jpg)
Research Products International Corp NADP [B-Nicotinamide Adenine Dinucleotide Phosphate, Oxidized Form, Monosodium Salt Trihydrate], 100 Milligrams
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
- Substance Name: β-Nicotinamide Adenine Dinucleotide Phosphate, Oxidized Form, Monosodium Salt Trihydrate
- CAS Number: 1184-16-3
- Molecular Formula: C21H27N7O17P3Na • 2H2O
- Molecular Weight: 801.4 g/mol
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
3,214
![eMolecules 13573-18-7 | Sodium tripolyphosphate | Combi-Blocks | MFCD00003514 | 367.860 | Na5O10P3 | 90.000 | [Na+].[Na+].[Na+].[Na+].[Na+].[O-]P([O-])(=O)OP([O-])(=O)OP([O-])([O-])=O | 25g | 537623392](https://assets.fishersci.com/TFS-Assets/CCG/product-images/502185599.JPG-250.jpg)
eMolecules 13573-18-7 | Sodium tripolyphosphate | Combi-Blocks | MFCD00003514 | 367.860 | Na5O10P3 | 90.000 | [Na+].[Na+].[Na+].[Na+].[Na+].[O-]P([O-])(=O)OP([O-])(=O)OP([O-])([O-])=O | 25g | 537623392
Sodium tripolyphosphate | Combi-Blocks | 13573-18-7 | MFCD00003514 | 367.860 | Na5O10P3 | 90.000 | [Na+].[Na+].[Na+].[Na+].[Na+].[O-]P([O-])(=O)OP([O-])(=O)OP([O-])([O-])=O | 25g | 537623392
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
3,215
eMolecules 1078-21-3 | 4-Amino-3-phenylbutanoic acid | MFCD00456233 | 1g
ChemScene | 4-Methyl[22-bipyridine]-4-butanoic acid | 100mg | 569144933 | CS-0085507 | 114527-28-5 | MFCD15144908 | 256.305 | C15H16N2O2
If you are unable to find the chemical you are looking for, make sure you are logged into your fishersci.com account and click on the following link:
eMolecules Building Block Tool
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
3,216
![eMolecules 13721-39-6 | Sodium orthovanadate | Combi-Blocks | MFCD00003511 | 184.915 | HNa3O4V | 95.000 | [OH-].[O--].[O--].[O--].[Na+].[Na+].[Na+].[V+4] | 25g | 290690905](https://assets.fishersci.com/TFS-Assets/CCG/product-images/502190237.JPG-250.jpg)
eMolecules 13721-39-6 | Sodium orthovanadate | Combi-Blocks | MFCD00003511 | 184.915 | HNa3O4V | 95.000 | [OH-].[O--].[O--].[O--].[Na+].[Na+].[Na+].[V+4] | 25g | 290690905
Sodium orthovanadate | Combi-Blocks | 13721-39-6 | MFCD00003511 | 184.915 | HNa3O4V | 95.000 | [OH-].[O--].[O--].[O--].[Na+].[Na+].[Na+].[V+4] | 25g | 290690905
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
3,217
Teknova 200mM Sodium Phosphate, pH 6.8. 1000mL, Sterile.
Sodium phosphate is a versatile chemical compound that has a wide range of uses. In molecular biology, it can be used to extract DNA and RNA from cells. In protein chemistry, it can be used to purify proteins. And in biochemical applications, it can be used to study enzyme activity. Sodium phosphate is also an effective buffering agent, making it an ideal solution for use in laboratory and industrial settings. The buffer range is 5.8 to 8.0.
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
3,218
Teknova 1M Potassium Chloride Solution. 500 mL, Sterile.
Potassium chloride solution, also known as KCl, is a salt that has a wide range of applications in molecular biology, protein chemistry and biochemical research. It is a key component of many biochemical reactions, including the synthesis of proteins and DNA. In addition, KCl is a popular reagent for the purification of proteins and nucleic acids.
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
3,219
Teknova Buffered Sodium Chloride-Peptone (0.19%) Solution, pH 7.0. 1000mL, Sterile.
0.19% Peptone,0.43% Sodium Chloride,0.36% Potassium Phosphate,0.57% Sodium Phosphate
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
3,220
Sigma Aldrich Fine Chemicals Biosciences Potassium phosphate monobasic suitable for HPLC, LiChropur(TM), 99.5-101.0% (T) | 7778-77-0 | MFCD00011401 | 50G
Potassium phosphate monobasic suitable for HPLC, LiChropur(TM), 99.5-101.0% (T) | Purity: 99.5-101.0% (T) | Mol Wt: 136.09 | 7778-77-0 | MFCD00011401 | 50G
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
3,221
Santa Cruz Biotechnology SANTA CRUZ BIOTECHNOLOGY
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
NC4000139 HEXADECYLSULFONYL FLUORIDE
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
3,222
SIGMA ALDRICH FINE CHEMICALS BIOSCIENCES TRI-SODIUM CITRATE DIHYD 1KG
NC3199525 TRI-SODIUM CITRATE DIHYD 1KG
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
3,223
Chemical Services Laboratories SODIUM CHLORIDE 0.05N SLVR NTR
NC3342613 SODIUM CHLORIDE 0.05N SLVR NTR
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
3,224
Hampton Research HR2-661/7.0 M Sodium nitrate - 200 ml
HR2-661/7.0 M Sodium nitrate - 200 ml. Please note items from this supplier are non-returnable.
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
3,225
Aqua Solutions Sodium Hydroxide 2.5% w/v Aqueous Solution (4L)
Sodium Hydroxide 2.5% w/v Aqueous Solution (4L)
Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More